PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_308669g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 192aa    MW: 21942.8 Da    PI: 8.5768
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_308669g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding414.6e-131459146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+WT+eEd +l+  ++ +G g+W++ +r  g+ R++k+c+ r  +
   MA_308669g0010 14 KGAWTPEEDARLIAHIRAHGEGCWRSLPRAAGLLRCGKSCRIRRIN 59
                     79******************************99*******87665 PP

2Myb_DNA-binding57.72.7e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++eEde ++++   lG++ W++Iar+++ gRt++++k++w++y
   MA_308669g0010  67 RGNFSEEEDEFIIKLYSTLGNK-WSLIARRLP-GRTDNEIKNYWNTY 111
                      89********************.*********.************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.6E-19565IPR009057Homeodomain-like
PROSITE profilePS5129411.737958IPR017930Myb domain
SuperFamilySSF466894.23E-2513108IPR009057Homeodomain-like
SMARTSM007174.0E-81363IPR001005SANT/Myb domain
PfamPF002491.7E-101459IPR001005SANT/Myb domain
PROSITE profilePS5129427.65262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-2666116IPR009057Homeodomain-like
SMARTSM007171.9E-1766114IPR001005SANT/Myb domain
PfamPF002491.5E-1667111IPR001005SANT/Myb domain
CDDcd001673.23E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTPE EDARLIAHIR AHGEGCWRSL PRAAGLLRCG KSCRIRRINY  60
PRPDVKRGNF SEEEDEFIIK LYSTLGNKWS LIARRLPGRT DNEIKNYWNT YIKKKLLKRG  120
LDHQFDSPLC SPHNSNTTRS SRPAPEHQIP AFQSPRTPEI ADFFQYDLSG CSPIEPAASK  180
DEEHPDINLD LC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ4699230.0FJ469923.1 Picea glauca R2R3-MYB transcription factor MYB17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028718.13e-81PREDICTED: myb-related protein 308-like
SwissprotP813938e-75MYB08_ANTMA; Myb-related protein 308
SwissprotQ9SZP11e-74MYB4_ARATH; Transcription repressor MYB4
TrEMBLC0JTD61e-129C0JTD6_PICGL; R2R3-MYB transcription factor MYB17
STRINGBRADI4G36460.16e-76(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.17e-76myb domain protein 4